PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00015.1.g05430.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 540aa    MW: 56590.1 Da    PI: 10.7852
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00015.1.g05430.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.92.6e-42231306176
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                                   +CqvegC++dl+  k+y+ rhkvC++h+k+p v+v+g+eqrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk+
  Zjn_sc00015.1.g05430.1.am.mk 231 RCQVEGCDVDLTGSKTYYYRHKVCSAHAKTPLVIVAGIEQRFCQQCSRFHQLSEFDQGKRSCRRRLAGHNERRRKP 306
                                   6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-33224293IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.915229306IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.93E-40230309IPR004333Transcription factor, SBP-box
PfamPF031108.0E-33232305IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MACYVALRFL LVPLASVHRP LAQNQKRLRR TQATLQKPRQ RAARHASSNS GGPSSATATA  60
FLPSIASAQP IAMASAKGGG RYKLGQLVCA RSRRVILSAK PPRSCPSASP LPSLSSLPER  120
EKRGAENLLP PLQSSSPRAF PAHRRTVMAT ASAGAGGGSS GGGGDDQLHG LKFGKKIFFE  180
DAGSTSGDGS SSGSGSGSAP PPPASPRATG GGRRGTGAAG GASSSSAQPA RCQVEGCDVD  240
LTGSKTYYYR HKVCSAHAKT PLVIVAGIEQ RFCQQCSRFH QLSEFDQGKR SCRRRLAGHN  300
ERRRKPPPGP LASRYGRFAA SFGEEPSRFR SFMLDFSYPR VPSSMRDGWP AARPGERVPG  360
SIQWQANLDP RHHHSAVAGY GIHPYGSQRS SAPRPSAFPG TEHPPGGGLA GAPADSSCAL  420
SLLSTQPWDT THSGSHDRAA TLSSTGGFGG NPVTPSLIAS NYITPSPWTG PPGHEGGQSV  480
PPQLPPEVPL DEVPSGPSHH GQFSGELELA LQGNRPAPRR MDHGSSSTFN QDGNPTDWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-302323051184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974838.11e-168PREDICTED: squamosa promoter-binding-like protein 14 isoform X1
SwissprotQ7EXZ21e-134SPL14_ORYSJ; Squamosa promoter-binding-like protein 14
TrEMBLK3YI011e-165K3YI01_SETIT; Uncharacterized protein
STRINGSi013870m1e-165(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-44squamosa promoter binding protein-like 9